PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D13G1716
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 313aa    MW: 34707.8 Da    PI: 8.395
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D13G1716genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.63.8e-1569114147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg W + Ed +l ++v+ +G+ +W++Ia+++  gR++k+c++rw++ 
      Gh_D13G1716  69 RGHWIPAEDAKLMELVTYYGPQNWNLIAEHLE-GRSGKSCRLRWFNQ 114
                      799*****************************.***********996 PP

2Myb_DNA-binding521.6e-16122163245
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                       ++T+eE+e l+ a++++G++ W++Iar +  gRt++ +k++w+
      Gh_D13G1716 122 RNFTEEEEEMLLVAHRLHGNK-WARIARLFD-GRTDNALKNHWH 163
                      68*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.35764115IPR017930Myb domain
SMARTSM007172.1E-1068117IPR001005SANT/Myb domain
SuperFamilySSF466892.7E-2769162IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.3E-2670122IPR009057Homeodomain-like
PfamPF139212.8E-1472132No hitNo description
CDDcd001674.02E-1072113No hitNo description
PROSITE profilePS5129423.805116170IPR017930Myb domain
SMARTSM007171.3E-13120168IPR001005SANT/Myb domain
CDDcd001676.74E-11123163No hitNo description
Gene3DG3DSA:1.10.10.601.3E-19123169IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MEQSNKCLSF EPLENRETMR TAGCDGKNGV WGVEEKGLTL NLDGEEDESN KNSSAVSGCK  60
SGNTKLCSRG HWIPAEDAKL MELVTYYGPQ NWNLIAEHLE GRSGKSCRLR WFNQLDPRIN  120
KRNFTEEEEE MLLVAHRLHG NKWARIARLF DGRTDNALKN HWHVITARKH REKSGVYKRK  180
KPSSYASRAL PKGLGLTIVN SACSASDQST ISSNIYQSAK VSSPVHQMDV SRRCSLFENV  240
ATRGIGYVVY QQGLMEAVTS VNRSATSLDS NSEVSAAESV GTNWTSHFIS GESCGNGNEK  300
IPFIDFLGVG RAS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-33691697107B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1167181RKHREKSGVYKRKKP
2168180KHREKSGVYKRKK
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM0527260.0KM052726.1 Gossypium hirsutum LOF-like transcription factor LOF2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012465763.10.0PREDICTED: transcriptional activator Myb-like
TrEMBLA0A0D2VG230.0A0A0D2VG23_G
STRINGPOPTR_0019s05740.11e-89(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12102896
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.13e-66myb domain protein 105